Skip to main navigation Skip to main content
  • KSPTM
  • E-Submission

PHD : Parasites, Hosts and Diseases

OPEN ACCESS
ABOUT
BROWSE ARTICLES
FOR CONTRIBUTORS

Articles

Brief Communication

Multi-Epitope Fusion Protein Eg mefAg-1 as a Serodiagnostic Candidate for Cystic Echinococcosis in Sheep

The Korean Journal of Parasitology 2019;57(1):61-67.
Published online: February 26, 2019

1College of Animal Science & Technology, Shihezi University, Shihezi, Xinjiang 832003, China

2State Key Laboratory for Sheep Genetic Improvement and Healthy Production, Xinjiang Academy of Agricultural and Reclamation Science, Shihezi, Xinjiang 832000, China

3State Key Laboratory of Veterinary Etiological Biology, Lanzhou Veterinary Research Institute, Chinese Academy of Agricultural Sciences, Lanzhou, Gansu 730046, China

*Corresponding author (xjmqlqj@sina.com)
• Received: May 1, 2018   • Revised: January 13, 2019   • Accepted: January 30, 2019

Copyright © 2019 by The Korean Society for Parasitology and Tropical Medicine

This is an Open Access article distributed under the terms of the Creative Commons Attribution Non-Commercial License (http://creativecommons.org/licenses/by-nc/4.0) which permits unrestricted non-commercial use, distribution, and reproduction in any medium, provided the original work is properly cited.

  • 8,071 Views
  • 131 Download
  • 6 Web of Science
  • 7 Crossref
  • 7 Scopus
prev next

Citations

Citations to this article as recorded by  Crossref logo
  • Therapeutic effects of IL-33/ST-2 pathway inhibition combined with albendazole on hepatic fibrosis and immune regulation in alveolar echinococcosis: in vivo and in vitro evidence
    Shi-Lei Cheng, Xiu-Mei Ma, Bin-Jie Wu, Yu-Xuan Yang, Hai-Ning Fan
    Parasites & Vectors.2026;[Epub]     CrossRef
  • Rapid and non‐invasive detection of cystic echinococcosis in sheep based on serum fluorescence spectrum combined with machine learning algorithms
    Shengke Xu, Wubulitalifu Dawuti, Maierhaba Maimaitiaili, Jingrui Dou, Malike Aizezi, Kalibixiati Aimulajiang, Xiaoyi Lü, Guodong Lü
    Journal of Biophotonics.2024;[Epub]     CrossRef
  • Recombinant multiepitope proteins expressed in Escherichia coli cells and their potential for immunodiagnosis
    Ana Alice Maia Gonçalves, Anna Julia Ribeiro, Carlos Ananias Aparecido Resende, Carolina Alves Petit Couto, Isadora Braga Gandra, Isabelle Caroline dos Santos Barcelos, Jonatas Oliveira da Silva, Juliana Martins Machado, Kamila Alves Silva, Líria Souza Si
    Microbial Cell Factories.2024;[Epub]     CrossRef
  • Expression and serodiagnostic efficacy of a novel echinococcosis-specific recombinant fusion antigen rAgB8/1-Em18-Eg95
    Yang Xianwei, Wang Tao, Chen Yin, Wang Wentao
    Parasitology.2024; 151(13): 1458.     CrossRef
  • Rapid and accurate screening of cystic echinococcosis in sheep based on serum Fourier‐transform infrared spectroscopy combined with machine learning algorithms
    Wubulitalifu Dawuti, Jingrui Dou, Xiangxiang Zheng, Xiaoyi Lü, Hui Zhao, Lingfei Yang, Renyong Lin, Guodong Lü
    Journal of Biophotonics.2023;[Epub]     CrossRef
  • Evaluation of a novel Echinococcus granulosus recombinant fusion B-EpC1 antigen for the diagnosis of human cystic echinococcosis using indirect ELISA in comparison with a commercial diagnostic ELISA kit
    Enayat Darabi, Elahe Motevaseli, Mehdi Mohebali, Mohammad Bagher Rokni, Mohammad Reza Khorramizadeh, Farzaneh Zahabiun, Soudabeh Heidari, Eshrat Beigom Kia
    Experimental Parasitology.2022; 240: 108339.     CrossRef
  • Detection of Echinococcus granulosus sensu lato infection by using extracts derived from a protoscoleces G1 cell line
    Andrea Maglioco, Jorge Gentile, Melisa S. Barbery Venturi, Oscar Jensen, Claudia Hernández, María Laura Gertiser, Verónica Poggio, Gabriela Canziani, Alicia Graciela Fuchs
    Parasite Immunology.2019;[Epub]     CrossRef

Download Citation

Download a citation file in RIS format that can be imported by all major citation management software, including EndNote, ProCite, RefWorks, and Reference Manager.

Format:

Include:

Multi-Epitope Fusion Protein Eg mefAg-1 as a Serodiagnostic Candidate for Cystic Echinococcosis in Sheep
Korean J Parasitol. 2019;57(1):61-67.   Published online February 26, 2019
Download Citation

Download a citation file in RIS format that can be imported by all major citation management software, including EndNote, ProCite, RefWorks, and Reference Manager.

Format:
Include:
Multi-Epitope Fusion Protein Eg mefAg-1 as a Serodiagnostic Candidate for Cystic Echinococcosis in Sheep
Korean J Parasitol. 2019;57(1):61-67.   Published online February 26, 2019
Close

Figure

  • 0
  • 1
  • 2
Multi-Epitope Fusion Protein Eg mefAg-1 as a Serodiagnostic Candidate for Cystic Echinococcosis in Sheep
Image Image Image
Fig. 1 Amino acid sequence of Eg mefAg-1 and its E. coli-codon optimized nucleotide sequence. A boxed GPG is linker.
Fig. 2 Induction and purification of reEg mefAg-1 on SDS-PAGE gel and Western blotting. Mr, protein molecular weight marker; lane 1, culture supernatant of E. coli BL21(DE3); lanes 2–4, IPTG-induced for 4, 6, and 8 hr; lanes 5–6, pET-28a (+) vector (control); lanes 7–8, purified reEg mefAg-1 protein; lane 9, western blot with anti-Eg positive serum.
Fig. 3 Antigenicity of Eg mefAg-1 toward sheep hydatidosis sera in ELISA. A cut-off line was set at OD 0.270. Eg PS, E. granulosus hydatid cyst positive; Eg NS, E. granulosus hydatid cyst negative; Ct PS, Cysticercus tenuicollis positive; Em PS, E. multilocularis cyst positive; Fh PS, F. hepatica positive.
Multi-Epitope Fusion Protein Eg mefAg-1 as a Serodiagnostic Candidate for Cystic Echinococcosis in Sheep

Epitope sequences selected from different antigen proteins of Echinococcus granulosus

Protein Epitope sequences Position
AgB1 (HM357141) DDGLTSTSRSVMKMFGEVKYFFERDPLGQKVVDLLEEL 1–38
AgB2 (HM357142) VVKKRWGELRDFFRND 11–26
AgB4 (HM357144) RDFFRSDPLGQK 19–30
AgB4 (HM357144) LEEEDEDDLK 61–70
Eg95 (AF465599) IETPRAGKKESTVM 120–133
TSP1 (KM459009) TGNCDQGKAQSANVTG 195–210
TSP6 (XP_024355367) TQAITAPDLTTPYPSS 150–165
RTN4 (KM459011) KFTEKPKREWR 185–195

Comparison among the results of necropsy, commercial anti-Echinococcus IgG ELISA Kit and Eg mefAg-1-ELISA in sheep sera

Necropsy Commercial anti-Echinococcus IgG ELISA Kit Total


Positive Negative Positive Negative
Eg mefAg-1-ELISA Positive 85 1 84 2 86
Negative 6 143 5 144 149
Total 91 144 89 146 235
Table 1 Epitope sequences selected from different antigen proteins of Echinococcus granulosus
Table 2 Comparison among the results of necropsy, commercial anti-Echinococcus IgG ELISA Kit and Eg mefAg-1-ELISA in sheep sera